PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G051300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 386aa    MW: 42379.5 Da    PI: 8.1158
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G051300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.7e-1857117257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Manes.17G051300.2.p  57 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 117
                          89*****************99*************************************995 PP

2Wus_type_Homeobox112.22.8e-3656118264
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  Manes.17G051300.2.p  56 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 118
                          689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-1252122IPR009057Homeodomain-like
PROSITE profilePS5007110.64153118IPR001356Homeobox domain
SMARTSM003896.8E-955122IPR001356Homeobox domain
CDDcd000861.04E-856118No hitNo description
Gene3DG3DSA:1.10.10.608.1E-756124IPR009057Homeodomain-like
PfamPF000462.0E-1557117IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNSH HHQWQHDITP SSLLSSACHR TPCASVPGCE ERSSEPKPRW  60
NPKPEQIRIL EAIFNSGMVN PPRDEIRKIR AQLQEYGQVG DANVFYWFQN RKSRSKHKLR  120
HLQNSMQQTH QAPSVTTSIP TLTAPSSSPS SSSEKSSPKA SQGTLSLTTP TVVDIFNSPT  180
GSVNQTYFQA HNEFVPEPFF FQAHQTGAGG GARPLTQGFC FSDLPNLVQV QDNTVGPCTS  240
LLLSEIMSSE ASKKYLYHED KNLKIQPRLS YPVTAPISHC IGFAPLPLPT THPNNVTVPS  300
TISQIQGESA SVGSSGAVRS TVFINDVAFE VGVGPFNLRE AFGDDFVLIH SSGQPVLTNE  360
WGVTFHSLQR GASYYLVPIS MNEHI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012092417.10.0PREDICTED: WUSCHEL-related homeobox 9-like
SwissprotQ6X7J47e-87WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A067JE430.0A0A067JE43_JATCU; Uncharacterized protein
STRINGPOPTR_0004s05090.11e-164(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.15e-70WUSCHEL related homeobox 8